ELISA Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0259 membrane protein YPK_2050 (YPK_2050)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pseudotubercµLosis serotype O:3 (strain YPIII) Uniprot NO.:B1JKS6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPITANTLYRDSFNFLRNQIAAILLLALLTAFITVmLNQTFMPASEQLSILSIPENDITS SGNLSISEIVSQMTPEQQMVLLRVSAVATFSALVGNVLLVGGLLTLIAMVSQGRRVSALQ AIGLSLPILPRLLVLMFISTLVIQLGLTFFIVPGVAIAIALSLSPIIVTNERMGIFAAMK ASAQLAFANVRLIVPAMmLWIAVKLLLLFLISRFTVLPPTIATIVLSTLSNLASALLLVY LFRLYmLLRPVSLDKQ Protein Names:Recommended name: UPF0259 membrane protein YPK_2050 Gene Names:Ordered Locus Names:YPK_2050 Expression Region:1-256 Sequence Info:fµLl length protein