ELISA Recombinant Shewanella woodyi UPF0761 membrane protein Swoo_4618 (Swoo_4618)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella woodyi (strain ATCC 51908 / MS32) Uniprot NO.:B1KLY8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKKKINLTQFQTLmLSIWHFMIHLKQRLAEDQINIRAGHLAYVSLLSLVPMVAVTMSmLS AFPVFQGIRGQIEDFIYNNFIPSAGDSVQVYINEFVDNASKGTAVGIAALMVVAImLISS IDKSLNSIWHTKEKRSMVISFSMYWMVLTLGPVLMGASLVATSYVVSLKVFNGSDLSGVV PLLVERLPmLFSVATFLLIYMVVPNTKVKFFHALLGAIVAALMFEFGKKGFALYLTKFPT YEAIYGALATIPILFLWVYLSWMIVLLGAVITAAMPEYLDKKQSAVEDKNGEKEVVSQVP DVSFSISELPQEQSQEQSQEPSLKPVEESIKESRVK Protein Names:Recommended name: UPF0761 membrane protein Swoo_4618 Gene Names:Ordered Locus Names:Swoo_4618 Expression Region:1-336 Sequence Info:fµLl length protein