ELISA Recombinant Shewanella woodyi Probable intracellular septation protein A (Swoo_2925)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella woodyi (strain ATCC 51908 / MS32) Uniprot NO.:B1KK11 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQLLDFLPLVIFFAVYKMYDIYIASGALIAATALQLIVTYALYKKIEKMHLITFVMVTF FGTLTLIFHDDAFIKWKVTVVYALFAIALAVSQLLNKPILKSmLGKELVVADKIWAHVTW YWVSFFVACGLVNIYVAFSLSQETWVNFKVFGLTALTLINTVITVVYLFKNMPEEHKKEL NK Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:Swoo_2925 Expression Region:1-182 Sequence Info:fµLl length protein