Skip to Content

ELISA Recombinant Platanus occidentalis NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC)

https://www.anagnostics.com/web/image/product.template/149855/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Platanus occidentalis (Sycamore) (American plane tree) Uniprot NO.:Q09G41 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVPVFIEALIFVLILIVGSVYAWRKGALEWS Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 Gene Names:Name:ndhC Expression Region:1-120 Sequence Info:fµLl length protein

1,462.00 € 1462.0 EUR 1,462.00 €

1,462.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.