ELISA Recombinant Syntrophomonas wolfei subsp. wolfei UPF0059 membrane protein Swol_2394(Swol_2394)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Syntrophomonas wolfei subsp. wolfei (strain Goettingen) Uniprot NO.:Q0AUC1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIEILITIILLAIVLGMDALSLAMGMGLRGVAKDYEKKFVLTVGILHVLMPLLGLNLGLV AGRFLGVWATRLGALVLVYLGWQmLSKGYAEIQPQRYNFAEAKTILAGKQQSTLDSWTSI LLLGLSVSIDALTVGFTLGTLKMPILITVLIMGLIAASMSWVGFAGGRVLGRLTGSYAQI LGGVVLLALAIKFVV Protein Names:Recommended name: UPF0059 membrane protein Swol_2394 Gene Names:Ordered Locus Names:Swol_2394 Expression Region:1-195 Sequence Info:fµLl length protein