Skip to Content

ELISA Recombinant Ustilago maydis NADH-ubiquinone oxidoreductase chain 3(ND3)

https://www.anagnostics.com/web/image/product.template/160378/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:Q0H8Y8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNTITLFFLFIPILAVILLFANLLLAVHRPDSEKVTPYECGFSPVYGQTRNPFSIQFYLV GILFLVFDIEILLTYPYAMNLYQTSTYGFWIFVIFFLVLTVGFVYEFGTGALYFTDKRSS IQNTKISDSKHSPFFWSKSEKRL Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3 Gene Names:Name:ND3 Synonyms:NAD3 Expression Region:1-143 Sequence Info:fµLl length protein

1,486.00 € 1486.0 EUR 1,486.00 €

1,486.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.