ELISA Recombinant Shewanella sp. Electron transport complex protein RnfA(rnfA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella sp. (strain MR-4) Uniprot NO.:Q0HII0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLGYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAAADVPMPFKGGAIAMITAGLM SLAFMGFTGLVK Protein Names:Recommended name: Electron transport complex protein RnfA Gene Names:Name:rnfA Ordered Locus Names:Shewmr4_2064 Expression Region:1-192 Sequence Info:fµLl length protein