ELISA Recombinant Vulpes vulpes Melanocortin receptor 4(MC4R)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:VµLpes vµLpes (Red fox) Uniprot NO.:Q0Z8I9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSTLQHGMHTSLHFWNRSTYGQHSNATESLGKGYPDGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADmLVSVSNGSETIVITLLNSTDTDAQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS GILFIIYSDSTAVIICLITMFFTmLALMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL IYALRSQELRKTFKEIICCYPLGGLCDLSSRY Protein Names:Recommended name: Melanocortin receptor 4 Short name= MC4-R Gene Names:Name:MC4R Expression Region:1-332 Sequence Info:fµLl length protein