ELISA Recombinant Xenopus laevis Protein FAM168B(fam168b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q0IHC4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYAGPNPAFQQELEHPAHVS SGVQMFMFGHAFSVARNGAIPSGYTPGTPYKVSCSPTSGTVPPYSSSPNPYQTAVYPVRS AYPQQNPYAQQGAYYTQPFYAAPPHVIHHTTVVQPNGMPATMYPAPIQSPRGNGVAMGMV AGTTMAMSAGTLLTSHYPSPVAPQVTMPTYRPPGTPTYSYVPPQW Protein Names:Recommended name: Protein FAM168B Gene Names:Name:fam168b Expression Region:1-225 Sequence Info:fµLl length protein