ELISA Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90A, mitochondrial(ccdc90a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q0P4J6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YFFDTHAVVQLLEANGFSAEQSEIVVSALVKILNVNMNLIHKDMVTKEQQEISLQQVMSL IASVKKDMIILEKSEFSALRTQNEKVKIELQQLKKQLNDSIVKVRASNKLDFNLEKSRVK EMHADNERKLLELRTSIVELHSQQDRGLTQTKRKIDTEVSGVKTMQESHKLDTIKYLAGS VFTCLTIALGFYRLWI Protein Names:Recommended name: Coiled-coil domain-containing protein 90A, mitochondrial Gene Names:Name:ccdc90a Expression Region:67-262 Sequence Info:fµLl length protein