ELISA Recombinant Schizosaccharomyces pombe GDT1-like protein C17G8.08c(SPAC17G8.08c)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q10320 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNPIKWAIIAVLLSTVVAKKIVGEGMADVSAIKHPEEVHPTNRDFLRSLIFSISMIFGC EIGDKTFIVAALLAFENSRLTVFAGSYSALFIMTLLGVLLGHAAPLLFPRKLTDILGGVL FVIFGIKmLMEAKEVMDSKESMSDEFQNVRNEIAANGPIDQLLEEGAAPSHYTGHRSRSG HTLMSQLKSKGRNVMATLFSPLFIKAFALTFVSEWGDRSQIATIAMAASDNVYGVFMGAN VGHACCTALAVISGKYISTKIKVHKVMFIGGILFIAFGLVYFYQGFF Protein Names:Recommended name: GDT1-like protein C17G8.08c Gene Names:ORF Names:SPAC17G8.08c Expression Region:1-287 Sequence Info:fµLl length protein