ELISA Recombinant Shewanella sp. UPF0114 protein Shewmr4_0646(Shewmr4_0646)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shewanella sp. (strain MR-4) Uniprot NO.:Q0HMJ1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHILPIIFEMTEVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMDVKNIDNDKIMWYLLIHITFVVSAFAMGYLDKMTRK Protein Names:Recommended name: UPF0114 protein Shewmr4_0646 Gene Names:Ordered Locus Names:Shewmr4_0646 Expression Region:1-162 Sequence Info:fµLl length protein