ELISA Recombinant Trichodesmium erythraeum Photosystem I assembly protein Ycf4(ycf4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Trichodesmium erythraeum (strain IMS101) Uniprot NO.:Q118V7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTQTSTGDRLVHQEIIGSRRLSNYLWAIIVTMGGIGFLLSGISSYLKVNLLIVADPTQL NFLPQGIAMSFYGLLGTIYGIFLWLTVIWDLGGGYNDFNQESGQIMIFRRGFPGKNRKVE FNCTTENVQSIKVDIKEGLNPRRAIYLCLKDRRQIPLTRVGQPLALSKLENEAAQLAKFL QVPLEGL Protein Names:Recommended name: Photosystem I assembly protein Ycf4 Gene Names:Name:ycf4 Ordered Locus Names:Tery_0512 Expression Region:1-187 Sequence Info:fµLl length protein