ELISA Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit(petC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain CC9311)
Uniprot NO.:Q0I872
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTQMPASDVPGMGRRQFMNLLTFGSVTGVALGALYPVANYFIPPRAAGGGGGTSAKDELG NSVTASGWLSSHAEGDRSLVQGLKGDPTYLIVEGVDAIGSYGINAICTHLGCVVPWNSGA NKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVDNDNVFVSQWTETDFRTGEKPWWS
Protein Names:Recommended name: Cytochrome b6-f complex iron-sµLfur subunit EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sµLfur protein Short name= ISP Short name= RISP Rieske iron-sµLfur protein
Gene Names:Name:petC Ordered Locus Names:sync_2149
Expression Region:1-178
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.