ELISA Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH3(41336)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q0IH10 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTSRCSHLPEVLPDCTSSAPSGKTVEDCSSLVNGQPQYVMQVSAKDGQLLSTVVRTLTT QSSFNDHPMCRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFS VERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLE AVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILVIPKSANLPSAQQSLLGL HSFKRNSKETIV Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH3 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 3 Membrane-associated RING-CH protein III Short name= MARCH-III Gene Names:Name:march3 Expression Region:1-252 Sequence Info:fµLl length protein