ELISA Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH3(41336)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q0IH10
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTSRCSHLPEVLPDCTSSAPSGKTVEDCSSLVNGQPQYVMQVSAKDGQLLSTVVRTLTT QSSFNDHPMCRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFS VERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLE AVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILVIPKSANLPSAQQSLLGL HSFKRNSKETIV
Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH3 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 3 Membrane-associated RING-CH protein III Short name= MARCH-III
Gene Names:Name:march3
Expression Region:1-252
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.