ELISA Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11(NDUFA11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:Q0MQB8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGQLEGWEVFAKPKV Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 Alternative name(s): Complex I-B14.7 Short name= CI-B14.7 NADH-ubiquinone oxidoreductase subunit B14.7 Gene Names:Name:NDUFA11 Expression Region:2-141 Sequence Info:fµLl length protein