Skip to Content

ELISA Recombinant Shigella flexneri serotype 5b Thiol:disulfide interchange protein DsbD(dsbD)

https://www.anagnostics.com/web/image/product.template/157336/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shigella flexneri serotype 5b (strain 8401) Uniprot NO.:Q0SXE3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAASQPVSVSQQEQHTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLmLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDVWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVmLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP Protein Names:Recommended name: Thiol:disµLfide interchange protein DsbD EC= 1.8.1.8 Alternative name(s): Protein-disµLfide reductase Short name= DisµLfide reductase Gene Names:Name:dsbD Ordered Locus Names:SFV_4292 Expression Region:20-565 Sequence Info:fµLl length protein

1,911.00 € 1911.0 EUR 1,911.00 €

1,911.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.