ELISA Recombinant Xenopus tropicalis Probable polyprenol reductase(srd5a3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q0P4J9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTLLALVWLLLDATFLITLLWHLLQGCKSGHSLLCSVFQDLIRYGKTKTGLQRPAWLQWF DIPKRCFWHFYCVSLIWNGCLLWILLRLLLQSVPVPEWLQLVLHFLHAGSEPQILDRELS VILALALLWLHSLRRLLECLFVSVFSNGVIHLVQYCFGLGYYFLIGITVLTYCPLDRRTV STDNLLTQCHWYHILGLALYIWASLHQYRCHCILAGLRKSASGNVINLNHSVPCGDWFER VSCPHYFAELLIYVSIAVVFGLLNTIWWLVVLYVLLNQALAALLCHEFYHEKFDTYPIHR KAFIPFIF Protein Names:Recommended name: Probable polyprenol reductase EC= 1.3.1.- Alternative name(s): 3-oxo-5-alpha-steroid 4-dehydrogenase 3 EC= 1.3.99.5 Steroid 5-alpha-reductase 3 Short name= S5AR 3 Short name= SR type 3 Gene Names:Name:srd5a3 Expression Region:1-308 Sequence Info:fµLl length protein