Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Probable undecaprenyl pyrophosphate synthase(NUS1)

https://www.anagnostics.com/web/image/product.template/154527/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q12063 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNSKTRALKAVTS IIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFYKFLLVLLYICFGLFRYGQYQ YNKMKLRIFSIIYNHAYTPQLIRQDVIPLKKIPKRLAAILEVKPVGDVGGGVTGLLNDAS EIVCWTVSAGIKHLmLYDYDGILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKI FYNLDGIETETDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKDNNEVIYSVFI RGLRQYAGCKVNVGK Protein Names:Recommended name: Probable undecaprenyl pyrophosphate synthase Short name= UPP synthase EC= 2.5.1.31 Alternative name(s): Di-trans,poly-cis-decaprenylcistransferase Nuclear undecaprenyl pyrophosphate synthase 1 Undecaprenyl d Gene Names:Name:NUS1 Ordered Locus Names:YDL193W ORF Names:D1239 Expression Region:1-375 Sequence Info:fµLl length protein

1,731.00 € 1731.0 EUR 1,731.00 €

1,731.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.