ELISA Recombinant Spodoptera frugiperda ascovirus 1a Uncharacterized protein ORF43(ORF43)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Spodoptera frµgiperda ascovirus 1a (SfAV-1a) Uniprot NO.:Q0E558 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSHTERIGQTPKAYVLANERGPFSVEVYLNPGTSNTYQYVATTRSKFNATDYDDLPWNYT SGKKVITANGVVSGGDRYVFALRSEIPQDIQVTMYNVNNGVSSNMNVRQPSDNSYYQPPP PPPPPRLVYNNGELYDNMINDTGYATELGKKLNDNFKKLWDYVNQPIVWLGVSALVGYLI YRYYYMSRPIGFGNSGAYDVPLLDTPLLRDSYRLPQSFTRDPIFRNSI Protein Names:Recommended name: Uncharacterized protein ORF43 Gene Names:ORF Names:ORF43 Expression Region:1-228 Sequence Info:fµLl length protein