ELISA Recombinant Shigella flexneri serotype 5b Cysteine-O-acetylserine efflux protein(eamB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shigella flexneri serotype 5b (strain 8401) Uniprot NO.:Q0T1S8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTPILLSAFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVmLLCAGI SFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKI ILYGVTALSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNI VLALLLVYCAVRIFY Protein Names:Recommended name: Cysteine/O-acetylserine efflux protein Gene Names:Name:eamB Ordered Locus Names:SFV_2641 Expression Region:1-195 Sequence Info:fµLl length protein