ELISA Recombinant Shigella flexneri serotype 5b Protease HtpX(htpX)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Shigella flexneri serotype 5b (strain 8401)
Uniprot NO.:Q0T522
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLMIMALLFGFGGSFVSLLMSKWMALR SVGGEVIEQPRNERERWLVNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRILAQLAAGFMGG NRDEGEESNGNPLIYFAVATVLELVFGILASIITMWFSRHREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRTGEYLK
Protein Names:Recommended name: Protease HtpX EC= 3.4.24.- Alternative name(s): Heat shock protein HtpX
Gene Names:Name:htpX Ordered Locus Names:SFV_1400
Expression Region:1-293
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.