ELISA Recombinant Xenopus tropicalis Post-GPI attachment to proteins factor 3(pgap3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q0VFE3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DREPVYRDCVTLCERNNCTGSRLTDFRAEQPLYMRVTGWTCLDDCRYQCMWYTVSLYLKE GHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLmLLRYRSSVPSSCQMYRTCLAFS MVSVNAWFWSTIFHTRDTALTEKMDYFCASSVILHSIYLCCMRTFGLQYPSIANGFGAFL VLLFACHVSYLTLGRFDYSYNMAANTGFGVLNLMWWLAWCFRRRFHQPYLWKCVLVVISL QSLALLELLDFPPVMWILDAHALWHFSTVPLHFLFYSFLKDDSLYLLKINHDDIPKLD Protein Names:Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): PER1-like domain-containing protein 1 Gene Names:Name:pgap3 Synonyms:perld1 Expression Region:19-316 Sequence Info:fµLl length protein