ELISA Recombinant Yersinia pestis bv. Antiqua UPF0756 membrane protein YPA_2248(YPA_2248)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pestis bv. Antiqua (strain Antiqua) Uniprot NO.:Q1C5Q9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPLNSFFPWVEKYGLTIGVLIL TIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQPSVVAGLLV GTVLGVALFKGVPVGPLIAAGLLSLVIGKS Protein Names:Recommended name: UPF0756 membrane protein YPA_2248 Gene Names:Ordered Locus Names:YPA_2248 Expression Region:1-150 Sequence Info:fµLl length protein