ELISA Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDL152W(YDL152W)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q12394 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAKTSSSSSSSNREWSSSLLLSPKVDCPSKTFSLLEAKSSTSFKPYGLISSPTSEVLVLF EPLRTILFYTPTLICFLFLQNFLYKSISEMSYDEMSFIIEFFFIAEAQFENFSSALQSPI F Protein Names:Recommended name: Putative uncharacterized protein YDL152W Gene Names:Ordered Locus Names:YDL152W ORF Names:D1551 Expression Region:1-121 Sequence Info:fµLl length protein