ELISA Recombinant Zea mays Aquaporin NIP2-1(NIP2-1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q19KC1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTNSRSNSRANFNNEIHDIGTAQNSSMPPTYYDRSLADIFPPHLLKKVVSEVVSTFLLV FVTCGAAGIYGSDKDRISQLGQSVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVFRHFP WIQVPFYWAAQFTGSICASFVLKAVLHPIAVLGTTTPTGPHWHSLVIEIIVTFNMMFVTL AVATDTRAVGELAGLAVGSAVCITSIFAGAVSGGSMNPARTLGPALASNLYTGLWIYFLG PVLGTLSGAWTYTYIRFEEAPSHKDMSQKLSSFKLRRLQSQSVAVDDDELDHIQV Protein Names:Recommended name: Aquaporin NIP2-1 Alternative name(s): NOD26-like intrinsic protein 2-1 ZmNIP2-1 ZmNIP2;1 Gene Names:Name:NIP2-1 Synonyms:LSI1 Expression Region:1-295 Sequence Info:fµLl length protein