ELISA Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W(YPR071W)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q12346 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQNGTEDKSNIPARSNDDVLPPLAVRLTMKVMRLIFIGKMFAYSFVPFPPFKLLTFDNTV GWFVAYSAIVSIWGFAVWMERGYRHKINLLPPRCTKIRCSRCNTRIRSPNWFKYKNWLYF FLLYVSLTTSNLIIQLASFMTEMSRRGISVPGTKDPGKRDYLGLIIPMRFIGAFIHYMTA NLFKEYYLHNGPLEKNDRPSTDEKTSENETL Protein Names:Recommended name: Uncharacterized membrane protein YPR071W Gene Names:Ordered Locus Names:YPR071W ORF Names:YP9499.26 Expression Region:1-211 Sequence Info:fµLl length protein