ELISA Recombinant Shewanella denitrificans Probable intracellular septation protein A(Sden_1467)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Uniprot NO.:Q12P74 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQLLDFLPLIIFFTVYKLVDIYTATGALIAATAVQIAILYFVYKKVEKMHLVTFAMVTV FGTLTLAFHDDAFIKWKVTIIYSLFAIALAVSQIMNKSIIKAmLGKELKADDNIWARVTW YWALFFIGCGVLNVYVAFSLPLETWVNFKVFGLTALTLLNTVISVFYIYKHAQPEQDDTA N Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:Sden_1467 Expression Region:1-181 Sequence Info:fµLl length protein