ELISA Recombinant Roseobacter denitrificans Prolipoprotein diacylglyceryl transferase(lgt)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) Uniprot NO.:Q162V9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRATIPFPDMSPEIFSISVFGFDLALRWYALAYIVGIVLGWRLVLRAVKRPDLWRDDQPV MTAAQIEDLLTWVIVGVILGGRLGYVFFYQPGYYLQNPSEILAVWQGGMAFHGGLLGVIA AGFIYTWRHRIARLSAADIMALGVPPGLLLGRIANFINAELWGRATDMPWGVAFPGAAAQ DCAGVEGICARHPSQLYEAGLEGLILGALLIWLVWKKAALKTPGYVAGVFFAGYGVSRFF VEFFRQPDAQFITDGNPLGLAWHINGWGLTMGQCLSLPMILLGIWLIARARHAA Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.- Gene Names:Name:lgt Ordered Locus Names:RD1_3501 Expression Region:1-294 Sequence Info:fµLl length protein