ELISA Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1(UCP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Suncus murinus (Asian house shrew) (Musk shrew) Uniprot NO.:Q18P97 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVASAEADVPPPTmLVKIASAGLSACLADIITFPLDTAKVRLQVQGERPNAPGVKYKGVL GTIATVAKTEGPLKLYGGLPAGIQRQISFASLRIGLYDTVQEYFNAHRKTPATLGNKISA GLMTGCVTVFIGQPTEVAKVRMQAQSSLHWLKPRYSGTYNAYYVIVKTEGFLGLWKGTSL NLTRNVIINCTELVVYDVLKEALVKNNVLADDIPCHLLAALTAGFCTTALASPVDVVKTR FINSPPGYYPHVHNCALNmLQKEGLRAFFKGFVPSFLRLGSWTVIMHVTFEQLKKELMKS RQTVDCAT Protein Names:Recommended name: Mitochondrial brown fat uncoupling protein 1 Short name= UCP 1 Alternative name(s): Solute carrier family 25 member 7 Thermogenin Gene Names:Name:UCP1 Synonyms:SLC25A7 Expression Region:1-308 Sequence Info:fµLl length protein