ELISA Recombinant Saccharomyces cerevisiae CTP-dependent diacylglycerol kinase 1(DGK1)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q12382
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGTEDAIALPNSTLEPRTEAKQRLSSKSHQVSAKVTIPAKEEISSSDDDAHVPVTEIHLK SHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQGINYKNVLWPLIYAFIILFILDLIRLN WPFFNmLYCRTVGALMRKKEIHTYNGVLWYILGLIFSFNFFSKDVTLISLFLLSWSDTAA ATIGRKYGHLTPKVARNKSLAGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPET SRLSLNmLSLLGGVVAALSEGIDLFNWDDNFTIPVLSSLFMNAVIKTFKK
Protein Names:Recommended name: CTP-dependent diacylglycerol kinase 1 EC= 2.7.1.n5 Alternative name(s): Diglyceride kinase 1 Short name= DAG kinase 1 High-copy suppressor of SLY1 defect protein 1
Gene Names:Name:DGK1 Synonyms:HSD1 Ordered Locus Names:YOR311C ORF Names:O6111
Expression Region:1-290
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.