Skip to Content

ELISA Recombinant Saccharomyces cerevisiae CTP-dependent diacylglycerol kinase 1(DGK1)

https://www.anagnostics.com/web/image/product.template/154252/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q12382 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGTEDAIALPNSTLEPRTEAKQRLSSKSHQVSAKVTIPAKEEISSSDDDAHVPVTEIHLK SHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQGINYKNVLWPLIYAFIILFILDLIRLN WPFFNmLYCRTVGALMRKKEIHTYNGVLWYILGLIFSFNFFSKDVTLISLFLLSWSDTAA ATIGRKYGHLTPKVARNKSLAGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPET SRLSLNmLSLLGGVVAALSEGIDLFNWDDNFTIPVLSSLFMNAVIKTFKK Protein Names:Recommended name: CTP-dependent diacylglycerol kinase 1 EC= 2.7.1.n5 Alternative name(s): Diglyceride kinase 1 Short name= DAG kinase 1 High-copy suppressor of SLY1 defect protein 1 Gene Names:Name:DGK1 Synonyms:HSD1 Ordered Locus Names:YOR311C ORF Names:O6111 Expression Region:1-290 Sequence Info:fµLl length protein

1,641.00 € 1641.0 EUR 1,641.00 €

1,641.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.