ELISA Recombinant Saccharomyces cerevisiae Protein YOP1(YOP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q12402 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEI LSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLK TVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH Protein Names:Recommended name: Protein YOP1 Alternative name(s): YIP1 partner protein 1 YPT-interacting protein 2 Gene Names:Name:YOP1 Synonyms:YIP2 Ordered Locus Names:YPR028W ORF Names:YP9367.08 Expression Region:2-180 Sequence Info:fµLl length protein