ELISA Recombinant Pseudoalteromonas atlantica ATP synthase subunit b 2(atpF2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) Uniprot NO.:Q15MU0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNINATLFGELLAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAK ATEQLKEAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDL RKQVAALAVAGAERILERQIDAAAQSDIVEKLVAEL Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2 Gene Names:Name:atpF2 Ordered Locus Names:Patl_4299 Expression Region:1-156 Sequence Info:fµLl length protein