ELISA Recombinant Yersinia pestis bv. Antiqua Cation-efflux pump FieF(fieF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yersinia pestis bv. Antiqua (strain Nepal516) Uniprot NO.:Q1CD32 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVDSLVDLAASLTNLFVV RYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRHLASPEPLQDPSIGIGV TLVALFSTLILVTFQRWVVRKTHSQAIRADmLHYQSDVLMNGAILIALALSWYGFRRADA LFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIVTSWPGVIGAHDLRTRRSG QTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVLIHQDPCSVVPKERHAHWEL Protein Names:Recommended name: Cation-efflux pump FieF Gene Names:Name:fieF Ordered Locus Names:YPN_3771 ORF Names:YP516_4291 Expression Region:1-300 Sequence Info:fµLl length protein