ELISA Recombinant Saccharomyces cerevisiae Pheromone-regulated membrane protein 4(PRM4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q12498 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIADSSVLKKHTAIKRSTRIISLTLVLLGVFSFLLLTWNDSLEFYNSADPSENKKNSEEE SEKKFVYKLPNLLKTADSFLSNENELNFQKVKEEISNIQSEVEVDIPEPSSKATSKFSSR SFQTDNVVTATTTTTLNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADS IFLKNLLQREFEISPELATVDLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNG ISVINRGMVRDIIEPHSKGLLLPLLKSEARGNLLVEKKDIPSNS Protein Names:Recommended name: Pheromone-regµLated membrane protein 4 Gene Names:Name:PRM4 Ordered Locus Names:YPL156C ORF Names:P2578 Expression Region:1-284 Sequence Info:fµLl length protein