ELISA Recombinant Shewanella denitrificans ATP synthase subunit a(atpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) Uniprot NO.:Q12HP5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAATGDALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGV PGKLQCLIEMIVEFVDASVKETFHGRNPVIAPLALTIFVWVFMMNFMDMIPVDWLPSLAL LAGVEYLKVVPTTDVNITFSLAIGVFVLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVN LLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYSANWAMATLGVGLQLGWLIFHIL VITLQAFIFMmLTIVYLSMAHEDH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Ordered Locus Names:Sden_3758 Expression Region:1-264 Sequence Info:fµLl length protein