ELISA Recombinant Saccharomyces cerevisiae Mitochondrial ornithine transporter 1(ORT1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q12375 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTY QNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVSPLGQILISGGVAGSC ASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRES FGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSV MQTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSAL Protein Names:Recommended name: Mitochondrial ornithine transporter 1 Gene Names:Name:ORT1 Synonyms:ARG11 Ordered Locus Names:YOR130C ORF Names:O3299, YOR3299C Expression Region:1-292 Sequence Info:fµLl length protein