Skip to Content

ELISA Recombinant Rhodopseudomonas palustris ATP synthase subunit b'(atpG)

https://www.anagnostics.com/web/image/product.template/153777/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodopseudomonas palustris (strain BisB5) Uniprot NO.:Q13CX3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAEGHGDAKGATAHTAADGGHKAPFPPFQKETFASQLVSLTIAFVALYLIVSKIILPRVG GVIEERQKTIEGDLAAAQKLKGESDDALKAYEAELAQARSRAQAIGAETREKLNAAAEAE RKTLEQRLAAKIADAEKTISATRTAAMGNVRGIASEAAAAIVQQLAGIQPDSKALDSAVN ASIKG Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b' Gene Names:Name:atpG Ordered Locus Names:RPD_0828 Expression Region:1-185 Sequence Info:fµLl length protein

1,530.00 € 1530.0 EUR 1,530.00 €

1,530.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.