ELISA Recombinant Rhodopseudomonas palustris ATP synthase subunit b'(atpG)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodopseudomonas palustris (strain BisB5)
Uniprot NO.:Q13CX3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAEGHGDAKGATAHTAADGGHKAPFPPFQKETFASQLVSLTIAFVALYLIVSKIILPRVG GVIEERQKTIEGDLAAAQKLKGESDDALKAYEAELAQARSRAQAIGAETREKLNAAAEAE RKTLEQRLAAKIADAEKTISATRTAAMGNVRGIASEAAAAIVQQLAGIQPDSKALDSAVN ASIKG
Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b'
Gene Names:Name:atpG Ordered Locus Names:RPD_0828
Expression Region:1-185
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.