ELISA Recombinant Roseobacter denitrificans Glycerol-3-phosphate acyltransferase(plsY)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) Uniprot NO.:Q163C2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIESTLPALALWGVIGYLLGSIPFGMVLAKVMGLGNLRDIGSGNIGATNVLRTGNKLAAA LTLVLDGGKGVVAVLAARAAGGEDLAQIAGLMAMIGHCYPVWLRFAGGKGVATFLGIVLA LAFPVGVGCCLAWLAGAFATRISSMGALVASVAAVPLAFLLGFPGAVVLLILLGALIFWR HRGNIARIRTGTEPKIGQKK Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati Gene Names:Name:plsY Ordered Locus Names:RD1_3430 Expression Region:1-200 Sequence Info:fµLl length protein