ELISA Recombinant Sphingopyxis alaskensis Large-conductance mechanosensitive channel(mscL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis) Uniprot NO.:Q1Gµg3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLGEFRQFIARGNVMDLAVGVIIGGAFATITGSLTEDVIMPLVGALFGGVDFSNRFILLG SVPDGMSATDYAALKEAGVAMIGYGAFVTAVINFLILAFIIFLLVRWVNKVVRKPEADAS PAGPSEVDLLTEIRDELRRK Protein Names:Recommended name: Large-conductance mechanosensitive channel Gene Names:Name:mscL Ordered Locus Names:Sala_0992 Expression Region:1-140 Sequence Info:fµLl length protein