ELISA Recombinant Silicibacter sp. Cobalamin biosynthesis protein CobD(cobD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Silicibacter sp. (strain TM1040) Uniprot NO.:Q1GDE9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTAALLIPAMILDAAFGEPKWLWSRLPHPAVLMGKLVQALDDRLNEGDGRQVKGVIAVA VLVFVGLLLGWILSWFGSLVSVLIAAILIAQRSLIDHVRAVATGLQNDLDAGRSAVAMIV SRDTATMTGPQIARSAIESGAENFSDGVIAPAFWFLVAGLPGLLIYKLINTADSMIGYRT EAYEDFGWAAARLDDVLNILPARLSALLIALVTGRAGDWGEISADARKHRSPNAGWPEAA MARALGVALAGPRSYDGEMRPFAWVNASGSKSASAHSITRCCEVLWKSWGLALVLVVALG LLF Protein Names:Recommended name: Cobalamin biosynthesis protein CobD Gene Names:Name:cobD Ordered Locus Names:TM1040_2585 Expression Region:1-303 Sequence Info:fµLl length protein