ELISA Recombinant Pseudomonas entomophila Potassium-transporting ATPase C chain(kdpC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas entomophila (strain L48) Uniprot NO.:Q1I7P1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTAYVRPALSLILLMTVVTGALYPLAVTGIAQVAFPKQANGSLVRDDRGEVRGSALIAQE FKGDGWFQSRPSAGAYATVASSASNLSPSNPALAERVKTDAAAQYQAQQGPVPQALLTTS GSGLDPHLPPEAIAYQLPRVAAARQVSEERLQVLVNDATLRPLIGPPVVNVLALNQALER LAPLAAR Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain Gene Names:Name:kdpC Ordered Locus Names:PSEEN3607 Expression Region:1-187 Sequence Info:fµLl length protein