ELISA Recombinant Yersinia pestis bv. Antiqua UPF0266 membrane protein YPN_2368(YPN_2368)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia pestis bv. Antiqua (strain Nepal516) Uniprot NO.:Q1CH34 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVTDLVLVVFIALLLIYAIYDEFIMNMMKGKTRLQVHLKRKNKLDCMIFVGLIGILIYN NVMAHGAPLTTYLLVGLALVAVYISYIRWPKLLFKNTGFFYANTFIEYSRIKSMNLSEDG ILVIDLEQRRLLIQVKKLDDLEKIYNFFIENQS Protein Names:Recommended name: UPF0266 membrane protein YPN_2368 Gene Names:Ordered Locus Names:YPN_2368 ORF Names:YP516_2666 Expression Region:1-153 Sequence Info:fµLl length protein