ELISA Recombinant Silicibacter sp. ATP synthase subunit b-b'(atpG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Silicibacter sp. (strain TM1040) Uniprot NO.:Q1GDE2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATTTHDAGHGAAEAAHGSSGMPQLDFSTYGNQIFWLLVTLVVIYLILSRIALPRIAAIL NERQGTITNDLAAAEDLKAKAVEAENAYNKALADARAEAQRIAAETRAEIQAEVDEAIAK ADAEISAKAAESEKAIAEIRAGALESVKVVAADTASALVAALGGKDDADAVKAAVAERTE G Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b' Gene Names:Name:atpG Ordered Locus Names:TM1040_2592 Expression Region:1-181 Sequence Info:fµLl length protein