Skip to Content

ELISA Recombinant Uroderma bilobatum NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)

https://www.anagnostics.com/web/image/product.template/160352/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Uroderma bilobatum (Tent-making bat) Uniprot NO.:Q1HV11 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLTYMNMFMAFMISLLGLLMYRSHMMSSLLCLEGMmLSLFVMMTVIILNTHLTLASMIP IILLVFAACEAALGLSLLVMVSTTYGMDYVQNLNLLQC Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L Gene Names:Name:MT-ND4L Synonyms:MTND4L, NADH4L, ND4L Expression Region:1-98 Sequence Info:fµLl length protein

1,438.00 € 1438.0 EUR 1,438.00 €

1,438.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.