ELISA Recombinant Rhizobium leguminosarum bv. viciae Glycerol-3-phosphate acyltransferase 2(plsY2)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rhizobium leguminosarum bv. viciae (strain 3841)
Uniprot NO.:Q1MGK1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVFWIAGAVGLAIAYLLGSTPSGYLAGKLIRGIDIREHGSKSTGATNVLRTLGKWPALVV LLVDVLKGVGAVVFARWFYSWFSTLSSGMPPTALDLQSLEPWAVCLTGLAVLLGHGRSVW LNFTGGKSVAAGLGVLLAMSWPVGLGAAMVFGVALAISRIVSLSSmLAALTAIALVCGLE QPLPYRLLVIAGGIYVIARHRTNIRRLLAGTEPRLGKVA
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 2 Alternative name(s): Acyl-PO4 G3P acyltransferase 2 Acyl-phosphate--glycerol-3-phosphate acyltransferase 2 G3P acyltransferase 2 Short name= GPAT 2 EC= 2.3.1.n3 Lys
Gene Names:Name:plsY2 Ordered Locus Names:RL2428
Expression Region:1-219
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.