Skip to Content

ELISA Recombinant Xenopus tropicalis Lysophospholipid acyltransferase LPCAT4(lpcat4)

https://www.anagnostics.com/web/image/product.template/161516/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q28C60 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEAEPVGEKGPAEDDGEESVPFNPFLHEFEPEGFWQKARFYILGFTLFPLRFLLAAIFL FLMWPIAALRVAGLTEEELSRSIRHRRTILHHLIYLLSRTMFFMCGFHWITIRGRRAPAS EAPLLVVAPHSTFFDPIVTVVCDLPSVVSRVENLNIPVIGALLRFNQSILVSRQDPSSRK KVVEEVKKRATSNGDWPQVLFFPEGTNGNGKVLLKFKPGAFVAGVPVQPVLMRYPNKLPA TIWTWKGNGVFKVLWLTMSQFYINLEIEFLPVYHPTAEERADPTLYASKVQKIMADALAK PATEFELIGDTPVTPVGHLKVALDPKIWELGNILEKAGFSLDSVQGLIDLCLEGVCSRVG LDELAEKLGVTQHDVISRVFNYFHKDASGMIDFREVSLVLAAQDATRSAEELAKLAFDLF STCDADGRFLLSADGFAAILRSVVGSPPAESGKVFSELCTYTELHGLTQDGFVRFAIRHP CYRHLFLFYLRPPSSGRRKPPHIQQNGGCSGKNNPRNQSKMD Protein Names:Recommended name: Lysophospholipid acyltransferase LPCAT4 EC= 2.3.1.- Alternative name(s): 1-acylglycerol-3-phosphate O-acyltransferase 7 Short name= 1-AGP acyltransferase 7 Short name= 1-AGPAT 7 Acyltransferase-like 3 Gene Names:Name:lpcat4 Synonyms:agpat7, aytl3 ORF Names:TEgg023j17.1 Expression Region:1-522 Sequence Info:fµLl length protein

1,886.00 € 1886.0 EUR 1,886.00 €

1,886.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.