ELISA Recombinant Sheep Type-2 angiotensin II receptor(AGTR2)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Ovis aries (Sheep)
Uniprot NO.:Q28929
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:PVLYYIIWGVGFLVNTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSHR YDWIFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLG WCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFI ATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVI NSCEVIAVIDLALPFAILLG
Protein Names:Recommended name: Type-2 angiotensin II receptor Alternative name(s): Angiotensin II type-2 receptor Short name= AT2
Gene Names:Name:AGTR2
Expression Region:1-260
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.