ELISA Recombinant Rickettsia bellii Probable ABC transporter permease protein RBE_1340(RBE_1340)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rickettsia bellii (strain RmL369-C) Uniprot NO.:Q1RGU3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLLNIANSIGKRTIRLAQSIGKFSIFSLAAITSIIRPPLYFSLIIKQLLFIGFYSLPVVA MTTFFSGAVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEI GTMRVTEQVDALYTLSTDSIKYLVFPKVIAAIITMPCLVLIGDVIGVMGGYLVGVYKLDF NSSTYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN SSILILISNYLITELFFKV Protein Names:Recommended name: Probable ABC transporter permease protein RBE_1340 Gene Names:Ordered Locus Names:RBE_1340 Expression Region:1-259 Sequence Info:fµLl length protein