ELISA Recombinant Desulfitobacterium hafniense UPF0060 membrane protein DSY4629(DSY4629)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:DesµLfitobacterium hafniense (strain Y51) Uniprot NO.:Q24NH4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFYAIILFILAGLAEIGGGYLVWLWLREAKPFWYGIIGGLILVLYGVIPTLQKFPSFGRV YAAYGGVFVILAVLWGWGIDKKVPDNYDWIGAVICLVGVSVmLWAPRN Protein Names:Recommended name: UPF0060 membrane protein DSY4629 Gene Names:Ordered Locus Names:DSY4629 Expression Region:1-108 Sequence Info:fµLl length protein